Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326
  1. Avatar for heather-1 101. heather-1 Lv 1 6 pts. 8,844
  2. Avatar for bamh 102. bamh Lv 1 6 pts. 8,823
  3. Avatar for tallguy-13088 103. tallguy-13088 Lv 1 5 pts. 8,818
  4. Avatar for Truncheon Luncheon 104. Truncheon Luncheon Lv 1 5 pts. 8,806
  5. Avatar for Mydogisa Toelicker 105. Mydogisa Toelicker Lv 1 5 pts. 8,799
  6. Avatar for flyflipper102 106. flyflipper102 Lv 1 5 pts. 8,796
  7. Avatar for Incongruous 107. Incongruous Lv 1 5 pts. 8,789
  8. Avatar for SKSbell 108. SKSbell Lv 1 5 pts. 8,775
  9. Avatar for Giant Berk 109. Giant Berk Lv 1 4 pts. 8,742
  10. Avatar for franse 110. franse Lv 1 4 pts. 8,715

Comments