Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326
  1. Avatar for JUMELLE54 111. JUMELLE54 Lv 1 4 pts. 8,703
  2. Avatar for agnairt 112. agnairt Lv 1 4 pts. 8,690
  3. Avatar for Datstandin 113. Datstandin Lv 1 4 pts. 8,675
  4. Avatar for doctaven 114. doctaven Lv 1 4 pts. 8,672
  5. Avatar for Jim Fraser 115. Jim Fraser Lv 1 3 pts. 8,671
  6. Avatar for Superphosphate 116. Superphosphate Lv 1 3 pts. 8,664
  7. Avatar for uihcv 117. uihcv Lv 1 3 pts. 8,654
  8. Avatar for silverberg 118. silverberg Lv 1 3 pts. 8,654
  9. Avatar for IHGreenman 119. IHGreenman Lv 1 3 pts. 8,585
  10. Avatar for t012 120. t012 Lv 1 3 pts. 8,532

Comments