Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups


  1. Avatar for Contenders 100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326

  1. Avatar for martinf 121. martinf Lv 1 3 pts. 8,497
  2. Avatar for pfirth 122. pfirth Lv 1 3 pts. 8,483
  3. Avatar for SouperGenious 123. SouperGenious Lv 1 3 pts. 8,476
  4. Avatar for proteansoup 124. proteansoup Lv 1 2 pts. 8,443
  5. Avatar for bhodg1 125. bhodg1 Lv 1 2 pts. 8,439
  6. Avatar for senor pit 126. senor pit Lv 1 2 pts. 8,426
  7. Avatar for weitzen 127. weitzen Lv 1 2 pts. 8,404
  8. Avatar for Greenlee 128. Greenlee Lv 1 2 pts. 8,397
  9. Avatar for harvardman 129. harvardman Lv 1 2 pts. 8,389
  10. Avatar for froggs554 130. froggs554 Lv 1 2 pts. 8,355

Comments