Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups


  1. Avatar for Contenders 100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326

  1. Avatar for TomTaylor 51. TomTaylor Lv 1 29 pts. 9,423
  2. Avatar for Scopper 52. Scopper Lv 1 28 pts. 9,422
  3. Avatar for tony46 53. tony46 Lv 1 28 pts. 9,418
  4. Avatar for Crossed Sticks 54. Crossed Sticks Lv 1 27 pts. 9,411
  5. Avatar for caglar 55. caglar Lv 1 26 pts. 9,371
  6. Avatar for Mike Cassidy 56. Mike Cassidy Lv 1 25 pts. 9,357
  7. Avatar for jamiexq 57. jamiexq Lv 1 25 pts. 9,344
  8. Avatar for BCAA 58. BCAA Lv 1 24 pts. 9,326
  9. Avatar for Seagat2011 59. Seagat2011 Lv 1 23 pts. 9,311
  10. Avatar for alwen 60. alwen Lv 1 23 pts. 9,307

Comments