Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326
  1. Avatar for arginia 71. arginia Lv 1 16 pts. 9,116
  2. Avatar for kitek314_pl 72. kitek314_pl Lv 1 16 pts. 9,114
  3. Avatar for aznarog 73. aznarog Lv 1 15 pts. 9,109
  4. Avatar for WarpSpeed 74. WarpSpeed Lv 1 15 pts. 9,107
  5. Avatar for hada 75. hada Lv 1 14 pts. 9,093
  6. Avatar for deLaCeiba 76. deLaCeiba Lv 1 14 pts. 9,061
  7. Avatar for ViJay7019 77. ViJay7019 Lv 1 13 pts. 9,053
  8. Avatar for Mr_Jolty 78. Mr_Jolty Lv 1 13 pts. 9,042
  9. Avatar for YGK 79. YGK Lv 1 13 pts. 9,033
  10. Avatar for fiendish_ghoul 80. fiendish_ghoul Lv 1 12 pts. 9,031

Comments