Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups


  1. Avatar for Contenders 100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326

  1. Avatar for drumpeter18yrs9yrs 61. drumpeter18yrs9yrs Lv 1 22 pts. 9,277
  2. Avatar for Vinara 62. Vinara Lv 1 21 pts. 9,262
  3. Avatar for jobo0502 63. jobo0502 Lv 1 21 pts. 9,261
  4. Avatar for gdnskye 64. gdnskye Lv 1 20 pts. 9,259
  5. Avatar for Deleted player 65. Deleted player 19 pts. 9,253
  6. Avatar for lynnai 66. lynnai Lv 1 19 pts. 9,204
  7. Avatar for stomjoh 67. stomjoh Lv 1 18 pts. 9,193
  8. Avatar for joremen 68. joremen Lv 1 18 pts. 9,150
  9. Avatar for ecali 69. ecali Lv 1 17 pts. 9,142
  10. Avatar for Mohambone 70. Mohambone Lv 1 17 pts. 9,121

Comments