Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for uihcv 131. uihcv Lv 1 3 pts. 8,680
  2. Avatar for martinf 132. martinf Lv 1 3 pts. 8,679
  3. Avatar for Pro Lapser 133. Pro Lapser Lv 1 3 pts. 8,679
  4. Avatar for Polyvinylchloride 134. Polyvinylchloride Lv 1 2 pts. 8,676
  5. Avatar for pandabearsecond 135. pandabearsecond Lv 1 2 pts. 8,672
  6. Avatar for brow42 136. brow42 Lv 1 2 pts. 8,654
  7. Avatar for Manderson7 137. Manderson7 Lv 1 2 pts. 8,650
  8. Avatar for mhresh 138. mhresh Lv 1 2 pts. 8,638
  9. Avatar for franse 139. franse Lv 1 2 pts. 8,629
  10. Avatar for jermainiac 140. jermainiac Lv 1 2 pts. 8,626

Comments