Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for Karton 121. Karton Lv 1 4 pts. 8,733
  2. Avatar for harvardman 122. harvardman Lv 1 4 pts. 8,732
  3. Avatar for BCAA 123. BCAA Lv 1 4 pts. 8,728
  4. Avatar for Soggy Doglog 124. Soggy Doglog Lv 1 3 pts. 8,720
  5. Avatar for TJOK fan 125. TJOK fan Lv 1 3 pts. 8,717
  6. Avatar for SWR_DMaster 126. SWR_DMaster Lv 1 3 pts. 8,713
  7. Avatar for TurtleByte 127. TurtleByte Lv 1 3 pts. 8,704
  8. Avatar for Truncheon Luncheon 128. Truncheon Luncheon Lv 1 3 pts. 8,692
  9. Avatar for rezaefar 129. rezaefar Lv 1 3 pts. 8,683
  10. Avatar for Inkedhands 130. Inkedhands Lv 1 3 pts. 8,681

Comments