Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909

  1. Avatar for navn 151. navn Lv 1 1 pt. 8,551
  2. Avatar for whodiopolis 152. whodiopolis Lv 1 1 pt. 8,551
  3. Avatar for bwkittitas 153. bwkittitas Lv 1 1 pt. 8,548
  4. Avatar for dahast.de 154. dahast.de Lv 1 1 pt. 8,542
  5. Avatar for JeNNeR 155. JeNNeR Lv 1 1 pt. 8,541
  6. Avatar for zo3xiaJonWeinberg 156. zo3xiaJonWeinberg Lv 1 1 pt. 8,538
  7. Avatar for val.sch67 157. val.sch67 Lv 1 1 pt. 8,535
  8. Avatar for gdnskye 158. gdnskye Lv 1 1 pt. 8,535
  9. Avatar for Arne Heessels 159. Arne Heessels Lv 1 1 pt. 8,533
  10. Avatar for Wheeler22 160. Wheeler22 Lv 1 1 pt. 8,533

Comments