Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for gurch 91. gurch Lv 1 11 pts. 8,810
  2. Avatar for smholst 92. smholst Lv 1 10 pts. 8,810
  3. Avatar for manu8170 93. manu8170 Lv 1 10 pts. 8,806
  4. Avatar for Crossed Sticks 94. Crossed Sticks Lv 1 10 pts. 8,805
  5. Avatar for georg137 95. georg137 Lv 1 9 pts. 8,805
  6. Avatar for froggs554 96. froggs554 Lv 1 9 pts. 8,803
  7. Avatar for wudoo 97. wudoo Lv 1 9 pts. 8,798
  8. Avatar for shettler 98. shettler Lv 1 8 pts. 8,793
  9. Avatar for TomTaylor 99. TomTaylor Lv 1 8 pts. 8,792
  10. Avatar for mitarcher 100. mitarcher Lv 1 8 pts. 8,791

Comments