Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for nemo7731 11. nemo7731 Lv 1 81 pts. 9,119
  2. Avatar for phi16 12. phi16 Lv 1 79 pts. 9,114
  3. Avatar for bertro 13. bertro Lv 1 77 pts. 9,099
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 75 pts. 9,096
  5. Avatar for mimi 15. mimi Lv 1 74 pts. 9,062
  6. Avatar for crpainter 16. crpainter Lv 1 72 pts. 9,060
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 70 pts. 9,059
  8. Avatar for KarenCH 18. KarenCH Lv 1 69 pts. 9,044
  9. Avatar for TomTaylor 19. TomTaylor Lv 1 67 pts. 9,037
  10. Avatar for pmdpmd 20. pmdpmd Lv 1 66 pts. 9,021

Comments