Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830
  1. Avatar for O Seki To 31. O Seki To Lv 1 51 pts. 8,963
  2. Avatar for gitwut 32. gitwut Lv 1 49 pts. 8,957
  3. Avatar for Satina 33. Satina Lv 1 48 pts. 8,938
  4. Avatar for aznarog 34. aznarog Lv 1 47 pts. 8,928
  5. Avatar for Bletchley Park 35. Bletchley Park Lv 1 46 pts. 8,915
  6. Avatar for drumpeter18yrs9yrs 36. drumpeter18yrs9yrs Lv 1 45 pts. 8,915
  7. Avatar for Glen B 37. Glen B Lv 1 44 pts. 8,914
  8. Avatar for dcrwheeler 38. dcrwheeler Lv 1 42 pts. 8,910
  9. Avatar for shettler 39. shettler Lv 1 41 pts. 8,908
  10. Avatar for Anfinsen_slept_here 40. Anfinsen_slept_here Lv 1 40 pts. 8,904

Comments