Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for RyeSnake 91. RyeSnake Lv 1 12 pts. 8,569
  2. Avatar for PrettyPony2001 92. PrettyPony2001 Lv 1 11 pts. 8,569
  3. Avatar for bx7gn 93. bx7gn Lv 1 11 pts. 8,565
  4. Avatar for dbuske 94. dbuske Lv 1 11 pts. 8,559
  5. Avatar for Vinara 95. Vinara Lv 1 10 pts. 8,558
  6. Avatar for uihcv 96. uihcv Lv 1 10 pts. 8,556
  7. Avatar for kitek314_pl 97. kitek314_pl Lv 1 10 pts. 8,547
  8. Avatar for zo3xiaJonWeinberg 98. zo3xiaJonWeinberg Lv 1 9 pts. 8,543
  9. Avatar for DrTree 99. DrTree Lv 1 9 pts. 8,541
  10. Avatar for ecali 100. ecali Lv 1 9 pts. 8,532

Comments