Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for Psych0Active 171. Psych0Active Lv 1 1 pt. 7,749
  2. Avatar for bwkittitas 172. bwkittitas Lv 1 1 pt. 7,741
  3. Avatar for 17581249_Juries 173. 17581249_Juries Lv 1 1 pt. 7,706
  4. Avatar for MaartenDesnouck 174. MaartenDesnouck Lv 1 1 pt. 7,665
  5. Avatar for jebbiek 175. jebbiek Lv 1 1 pt. 7,619
  6. Avatar for cherry39 176. cherry39 Lv 1 1 pt. 7,572
  7. Avatar for Sydefecks 177. Sydefecks Lv 1 1 pt. 7,514
  8. Avatar for DrTree 178. DrTree Lv 1 1 pt. 7,426
  9. Avatar for Tac1 179. Tac1 Lv 1 1 pt. 7,388
  10. Avatar for aspadistra 180. aspadistra Lv 1 1 pt. 7,312

Comments