Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for froggs554 111. froggs554 Lv 1 5 pts. 8,462
  2. Avatar for D7xbase 112. D7xbase Lv 1 5 pts. 8,461
  3. Avatar for Flagg65a 113. Flagg65a Lv 1 5 pts. 8,448
  4. Avatar for t012 114. t012 Lv 1 4 pts. 8,436
  5. Avatar for Punktchen 115. Punktchen Lv 1 4 pts. 8,419
  6. Avatar for tela 116. tela Lv 1 4 pts. 8,417
  7. Avatar for Inkedhands 117. Inkedhands Lv 1 4 pts. 8,412
  8. Avatar for pfirth 118. pfirth Lv 1 4 pts. 8,377
  9. Avatar for SouperGenious 119. SouperGenious Lv 1 4 pts. 8,377
  10. Avatar for Deleted player 120. Deleted player pts. 8,366

Comments