Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 81 pts. 9,115
  2. Avatar for tarimo 12. tarimo Lv 1 79 pts. 9,095
  3. Avatar for gitwut 13. gitwut Lv 1 78 pts. 9,092
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 76 pts. 9,089
  5. Avatar for Susume 15. Susume Lv 1 74 pts. 9,073
  6. Avatar for mimi 16. mimi Lv 1 73 pts. 9,062
  7. Avatar for Galaxie 17. Galaxie Lv 1 71 pts. 9,049
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 69 pts. 9,007
  9. Avatar for gloverd 19. gloverd Lv 1 68 pts. 8,993
  10. Avatar for Deleted player 20. Deleted player pts. 8,983

Comments