Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for g_b 21. g_b Lv 1 65 pts. 8,971
  2. Avatar for grogar7 22. grogar7 Lv 1 63 pts. 8,968
  3. Avatar for TomTaylor 23. TomTaylor Lv 1 62 pts. 8,957
  4. Avatar for johnmitch 24. johnmitch Lv 1 61 pts. 8,942
  5. Avatar for BrKapr 25. BrKapr Lv 1 59 pts. 8,941
  6. Avatar for Museka 26. Museka Lv 1 58 pts. 8,939
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 56 pts. 8,937
  8. Avatar for nicobul 28. nicobul Lv 1 55 pts. 8,936
  9. Avatar for LociOiling 29. LociOiling Lv 1 54 pts. 8,935
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 53 pts. 8,919

Comments