Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for mitarcher 131. mitarcher Lv 1 2 pts. 8,401
  2. Avatar for Merf 132. Merf Lv 1 2 pts. 8,363
  3. Avatar for Psych0Active 133. Psych0Active Lv 1 2 pts. 8,347
  4. Avatar for NotJim99 134. NotJim99 Lv 1 2 pts. 8,340
  5. Avatar for dak3910 135. dak3910 Lv 1 2 pts. 8,336
  6. Avatar for karost 136. karost Lv 1 1 pt. 8,311
  7. Avatar for 01010011111 137. 01010011111 Lv 1 1 pt. 8,310
  8. Avatar for GregoryWiid 138. GregoryWiid Lv 1 1 pt. 8,309
  9. Avatar for Avelas67 139. Avelas67 Lv 1 1 pt. 8,305
  10. Avatar for lange 140. lange Lv 1 1 pt. 8,288

Comments