Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for alwen 71. alwen Lv 1 16 pts. 8,959
  2. Avatar for ecali 72. ecali Lv 1 15 pts. 8,938
  3. Avatar for Bautho 73. Bautho Lv 1 15 pts. 8,920
  4. Avatar for bcd 74. bcd Lv 1 14 pts. 8,919
  5. Avatar for weitzen 75. weitzen Lv 1 14 pts. 8,918
  6. Avatar for joremen 76. joremen Lv 1 13 pts. 8,918
  7. Avatar for Superphosphate 77. Superphosphate Lv 1 13 pts. 8,917
  8. Avatar for andrewxc 78. andrewxc Lv 1 13 pts. 8,917
  9. Avatar for kitek314_pl 79. kitek314_pl Lv 1 12 pts. 8,899
  10. Avatar for caglar 80. caglar Lv 1 12 pts. 8,883

Comments