1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Summary

• Created: March 08, 2016
• Expires: March 16, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

• 1. Beta Folders 100 pts. 10,127
• 2. Go Science 80 pts. 10,114
• 3. Contenders 63 pts. 10,081
• 4. Anthropic Dreams 49 pts. 10,064
• 5. L'Alliance Francophone 37 pts. 10,031
• 6. Void Crushers 28 pts. 10,009
• 7. Gargleblasters 21 pts. 10,009
• 8. Deleted group pts. 9,945
• 9. HMT heritage 11 pts. 9,928
• 10. BOINC@Poland 8 pts. 9,819

Top soloists

• 51. kitek314_pl 31 pts. 9,819
• 52. Museka 30 pts. 9,819
• 53. deLaCeiba 29 pts. 9,818
• 54. packer 28 pts. 9,816
• 55. Paulo Roque 27 pts. 9,815
• 56. YeshuaLives 27 pts. 9,807
• 57. Crossed Sticks 26 pts. 9,791
• 58. weitzen 25 pts. 9,790
• 59. WarpSpeed 25 pts. 9,787
• 60. hallenberg 24 pts. 9,776