Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665

  1. Avatar for yoyoparis 141. yoyoparis Lv 1 1 pt. 9,361
  2. Avatar for Komeiji_Koishi 142. Komeiji_Koishi Lv 1 1 pt. 9,356
  3. Avatar for Origami314 143. Origami314 Lv 1 1 pt. 9,355
  4. Avatar for lamoille 144. lamoille Lv 1 1 pt. 9,346
  5. Avatar for Wheeler22 145. Wheeler22 Lv 1 1 pt. 9,343
  6. Avatar for DrTree 146. DrTree Lv 1 1 pt. 9,336
  7. Avatar for ratqueen03 147. ratqueen03 Lv 1 1 pt. 9,332
  8. Avatar for multaq 148. multaq Lv 1 1 pt. 9,309
  9. Avatar for Deleted player 149. Deleted player 1 pt. 9,287
  10. Avatar for lockert 150. lockert Lv 1 1 pt. 9,284

Comments