Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for Skippysk8s 11. Skippysk8s Lv 1 78 pts. 9,579
  2. Avatar for gcm24 12. gcm24 Lv 1 76 pts. 9,559
  3. Avatar for mirp 13. mirp Lv 1 74 pts. 9,551
  4. Avatar for bertro 14. bertro Lv 1 72 pts. 9,547
  5. Avatar for LociOiling 15. LociOiling Lv 1 71 pts. 9,546
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 69 pts. 9,537
  7. Avatar for Deleted player 17. Deleted player pts. 9,522
  8. Avatar for MurloW 18. MurloW Lv 1 65 pts. 9,511
  9. Avatar for frood66 19. frood66 Lv 1 64 pts. 9,507
  10. Avatar for jeff101 20. jeff101 Lv 1 62 pts. 9,465

Comments