Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for Marvelz 41. Marvelz Lv 1 34 pts. 9,182
  2. Avatar for tallguy-13088 42. tallguy-13088 Lv 1 33 pts. 9,162
  3. Avatar for gloverd 43. gloverd Lv 1 32 pts. 9,151
  4. Avatar for YeshuaLives 44. YeshuaLives Lv 1 31 pts. 9,131
  5. Avatar for mimi 45. mimi Lv 1 30 pts. 9,131
  6. Avatar for Blipperman 46. Blipperman Lv 1 29 pts. 9,130
  7. Avatar for tarimo 47. tarimo Lv 1 28 pts. 9,129
  8. Avatar for freethought78 48. freethought78 Lv 1 27 pts. 9,123
  9. Avatar for caglar 49. caglar Lv 1 27 pts. 9,112
  10. Avatar for crpainter 50. crpainter Lv 1 26 pts. 9,106

Comments