Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for YumatovShow 181. YumatovShow Lv 1 1 pt. 2,428
  2. Avatar for _Cyber_ 182. _Cyber_ Lv 1 1 pt. 2,382
  3. Avatar for Abrolhos 183. Abrolhos Lv 1 1 pt. 2,363
  4. Avatar for Deleted player 184. Deleted player pts. 2,301
  5. Avatar for wisejack 185. wisejack Lv 1 1 pt. 2,293
  6. Avatar for Montorio 186. Montorio Lv 1 1 pt. 1,600
  7. Avatar for DScott 187. DScott Lv 1 1 pt. 1,174
  8. Avatar for zkm 188. zkm Lv 1 1 pt. 967
  9. Avatar for MaartenDesnouck 189. MaartenDesnouck Lv 1 1 pt. 924
  10. Avatar for snaboofypop 190. snaboofypop Lv 1 1 pt. 25

Comments