Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for AndriiMiller 171. AndriiMiller Lv 1 1 pt. 3,800
  2. Avatar for Krogh 172. Krogh Lv 1 1 pt. 3,670
  3. Avatar for Stephen R 173. Stephen R Lv 1 1 pt. 3,595
  4. Avatar for Museka 174. Museka Lv 1 1 pt. 3,498
  5. Avatar for penteplayer 175. penteplayer Lv 1 1 pt. 3,208
  6. Avatar for puxatudo 176. puxatudo Lv 1 1 pt. 3,185
  7. Avatar for kvasirthewise 177. kvasirthewise Lv 1 1 pt. 3,173
  8. Avatar for Monofilo 178. Monofilo Lv 1 1 pt. 2,673
  9. Avatar for Ciccillo 179. Ciccillo Lv 1 1 pt. 2,640
  10. Avatar for D.Brady 180. D.Brady Lv 1 1 pt. 2,528

Comments