Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for aspadistra 191. aspadistra Lv 1 1 pt. 0
  2. Avatar for heyubob 192. heyubob Lv 1 1 pt. 0
  3. Avatar for razzo11 193. razzo11 Lv 1 1 pt. 0
  4. Avatar for Sergey42 194. Sergey42 Lv 1 1 pt. 0
  5. Avatar for ivalnic 195. ivalnic Lv 1 1 pt. 0
  6. Avatar for GreenSlugg 196. GreenSlugg Lv 1 1 pt. 0
  7. Avatar for jermainiac 197. jermainiac Lv 1 1 pt. 0
  8. Avatar for inkycatz 198. inkycatz Lv 1 1 pt. 0
  9. Avatar for Corruption 200. Corruption Lv 1 1 pt. 0

Comments