Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for pmdpmd 51. pmdpmd Lv 1 25 pts. 9,105
  2. Avatar for johnmitch 52. johnmitch Lv 1 24 pts. 9,078
  3. Avatar for O Seki To 53. O Seki To Lv 1 23 pts. 9,018
  4. Avatar for fishercat 54. fishercat Lv 1 23 pts. 9,016
  5. Avatar for Satina 55. Satina Lv 1 22 pts. 8,971
  6. Avatar for Vinara 56. Vinara Lv 1 21 pts. 8,968
  7. Avatar for pvc78 57. pvc78 Lv 1 21 pts. 8,964
  8. Avatar for smilingone 58. smilingone Lv 1 20 pts. 8,963
  9. Avatar for Bautho 59. Bautho Lv 1 19 pts. 8,934
  10. Avatar for weitzen 60. weitzen Lv 1 19 pts. 8,933

Comments