Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,172
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,965
  3. Avatar for Go Science 3. Go Science 49 pts. 9,958
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,955
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,938
  6. Avatar for Contenders 6. Contenders 14 pts. 9,916
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,901
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,882
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 3 pts. 9,642
  10. Avatar for Deleted group 10. Deleted group pts. 9,637
  1. Avatar for pauldunn 11. pauldunn Lv 1 76 pts. 9,892
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 74 pts. 9,885
  3. Avatar for gitwut 13. gitwut Lv 1 72 pts. 9,882
  4. Avatar for nicobul 14. nicobul Lv 1 70 pts. 9,882
  5. Avatar for jermainiac 15. jermainiac Lv 1 68 pts. 9,872
  6. Avatar for KarenCH 16. KarenCH Lv 1 66 pts. 9,862
  7. Avatar for Galaxie 17. Galaxie Lv 1 64 pts. 9,861
  8. Avatar for frood66 18. frood66 Lv 1 62 pts. 9,838
  9. Avatar for toshiue 19. toshiue Lv 1 60 pts. 9,838
  10. Avatar for Scopper 20. Scopper Lv 1 59 pts. 9,827

Comments