1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Summary

• Created: May 11, 2016
• Expires: May 18, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

• 1. Beta Folders 100 pts. 10,172
• 2. Anthropic Dreams 71 pts. 9,965
• 3. Go Science 49 pts. 9,958
• 4. Gargleblasters 33 pts. 9,955
• 5. Void Crushers 22 pts. 9,938
• 6. Contenders 14 pts. 9,916
• 7. HMT heritage 8 pts. 9,901
• 8. L'Alliance Francophone 5 pts. 9,882
• 9. D001x Med Chem MOOC 3 pts. 9,642
• 10. Deleted group pts. 9,637

Top soloists

• 41. christioanchauvin 30 pts. 9,687
• 42. Anfinsen_slept_here 29 pts. 9,685
• 43. Dempy 28 pts. 9,683
• 44. pvc78 27 pts. 9,656
• 45. smholst 26 pts. 9,644
• 46. D001x_ErlandStevens 25 pts. 9,642
• 47. mimi 24 pts. 9,640
• 48. drumpeter18yrs9yrs 24 pts. 9,637
• 49. Glen B 23 pts. 9,624
• 50. Idiotboy 22 pts. 9,624