Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890

  1. Avatar for matosfran 21. matosfran Lv 1 49 pts. 9,971
  2. Avatar for Galaxie 22. Galaxie Lv 1 47 pts. 9,965
  3. Avatar for Bruno Kestemont 23. Bruno Kestemont Lv 1 45 pts. 9,964
  4. Avatar for tokens 24. tokens Lv 1 44 pts. 9,961
  5. Avatar for O Seki To 25. O Seki To Lv 1 42 pts. 9,957
  6. Avatar for joremen 26. joremen Lv 1 40 pts. 9,946
  7. Avatar for pmdpmd 27. pmdpmd Lv 1 39 pts. 9,944
  8. Avatar for toshiue 28. toshiue Lv 1 37 pts. 9,940
  9. Avatar for g_b 29. g_b Lv 1 36 pts. 9,933
  10. Avatar for jobo0502 30. jobo0502 Lv 1 34 pts. 9,929

Comments