Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for Satina 91. Satina Lv 1 1 pt. 9,427
  2. Avatar for SouperGenious 92. SouperGenious Lv 1 1 pt. 9,412
  3. Avatar for bendbob 93. bendbob Lv 1 1 pt. 9,390
  4. Avatar for jamiexq 94. jamiexq Lv 1 1 pt. 9,389
  5. Avatar for navn 95. navn Lv 1 1 pt. 9,381
  6. Avatar for YeshuaLives 96. YeshuaLives Lv 1 1 pt. 9,365
  7. Avatar for momadoc 97. momadoc Lv 1 1 pt. 9,358
  8. Avatar for smholst 98. smholst Lv 1 1 pt. 9,351
  9. Avatar for BCAA 99. BCAA Lv 1 1 pt. 9,349
  10. Avatar for Deleted player 100. Deleted player 1 pt. 9,298

Comments