Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890
  1. Avatar for Satina 91. Satina Lv 1 1 pt. 9,427
  2. Avatar for SouperGenious 92. SouperGenious Lv 1 1 pt. 9,412
  3. Avatar for bendbob 93. bendbob Lv 1 1 pt. 9,390
  4. Avatar for jamiexq 94. jamiexq Lv 1 1 pt. 9,389
  5. Avatar for navn 95. navn Lv 1 1 pt. 9,381
  6. Avatar for YeshuaLives 96. YeshuaLives Lv 1 1 pt. 9,365
  7. Avatar for momadoc 97. momadoc Lv 1 1 pt. 9,358
  8. Avatar for smholst 98. smholst Lv 1 1 pt. 9,351
  9. Avatar for BCAA 99. BCAA Lv 1 1 pt. 9,349
  10. Avatar for Deleted player 100. Deleted player 1 pt. 9,298

Comments