Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for crpainter 51. crpainter Lv 1 13 pts. 9,824
  2. Avatar for caglar 52. caglar Lv 1 13 pts. 9,823
  3. Avatar for dbuske 53. dbuske Lv 1 12 pts. 9,804
  4. Avatar for egran48 54. egran48 Lv 1 12 pts. 9,803
  5. Avatar for Superphosphate 55. Superphosphate Lv 1 11 pts. 9,799
  6. Avatar for stomjoh 56. stomjoh Lv 1 10 pts. 9,783
  7. Avatar for Anfinsen_slept_here 57. Anfinsen_slept_here Lv 1 10 pts. 9,771
  8. Avatar for Vinara 58. Vinara Lv 1 9 pts. 9,764
  9. Avatar for guineapig 59. guineapig Lv 1 9 pts. 9,760
  10. Avatar for christioanchauvin 60. christioanchauvin Lv 1 9 pts. 9,758

Comments