Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890
  1. Avatar for crpainter 51. crpainter Lv 1 13 pts. 9,824
  2. Avatar for caglar 52. caglar Lv 1 13 pts. 9,823
  3. Avatar for dbuske 53. dbuske Lv 1 12 pts. 9,804
  4. Avatar for egran48 54. egran48 Lv 1 12 pts. 9,803
  5. Avatar for Superphosphate 55. Superphosphate Lv 1 11 pts. 9,799
  6. Avatar for stomjoh 56. stomjoh Lv 1 10 pts. 9,783
  7. Avatar for Anfinsen_slept_here 57. Anfinsen_slept_here Lv 1 10 pts. 9,771
  8. Avatar for Vinara 58. Vinara Lv 1 9 pts. 9,764
  9. Avatar for guineapig 59. guineapig Lv 1 9 pts. 9,760
  10. Avatar for christioanchauvin 60. christioanchauvin Lv 1 9 pts. 9,758

Comments