Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for Deleted player 61. Deleted player 8 pts. 9,721
  2. Avatar for Amphimixus 62. Amphimixus Lv 1 8 pts. 9,708
  3. Avatar for ManVsYard 63. ManVsYard Lv 1 7 pts. 9,702
  4. Avatar for NinjaGreg 64. NinjaGreg Lv 1 7 pts. 9,699
  5. Avatar for altejoh 65. altejoh Lv 1 7 pts. 9,670
  6. Avatar for WBarme1234 66. WBarme1234 Lv 1 6 pts. 9,653
  7. Avatar for Jumbly 67. Jumbly Lv 1 6 pts. 9,648
  8. Avatar for Geyalust 68. Geyalust Lv 1 6 pts. 9,644
  9. Avatar for fishercat 69. fishercat Lv 1 5 pts. 9,635
  10. Avatar for tallguy-13088 70. tallguy-13088 Lv 1 5 pts. 9,617

Comments