Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890
  1. Avatar for Deleted player 61. Deleted player 8 pts. 9,721
  2. Avatar for Amphimixus 62. Amphimixus Lv 1 8 pts. 9,708
  3. Avatar for ManVsYard 63. ManVsYard Lv 1 7 pts. 9,702
  4. Avatar for NinjaGreg 64. NinjaGreg Lv 1 7 pts. 9,699
  5. Avatar for altejoh 65. altejoh Lv 1 7 pts. 9,670
  6. Avatar for WBarme1234 66. WBarme1234 Lv 1 6 pts. 9,653
  7. Avatar for Jumbly 67. Jumbly Lv 1 6 pts. 9,648
  8. Avatar for Geyalust 68. Geyalust Lv 1 6 pts. 9,644
  9. Avatar for fishercat 69. fishercat Lv 1 5 pts. 9,635
  10. Avatar for tallguy-13088 70. tallguy-13088 Lv 1 5 pts. 9,617

Comments