Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for uihcv 71. uihcv Lv 1 5 pts. 9,611
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 4 pts. 9,611
  3. Avatar for phi16 73. phi16 Lv 1 4 pts. 9,608
  4. Avatar for carsonfb 74. carsonfb Lv 1 4 pts. 9,558
  5. Avatar for Glen B 75. Glen B Lv 1 4 pts. 9,539
  6. Avatar for Mike Lewis 76. Mike Lewis Lv 1 4 pts. 9,539
  7. Avatar for ViJay7019 77. ViJay7019 Lv 1 3 pts. 9,536
  8. Avatar for aendgraend 78. aendgraend Lv 1 3 pts. 9,535
  9. Avatar for Aikuiba 79. Aikuiba Lv 1 3 pts. 9,523
  10. Avatar for DScott 80. DScott Lv 1 3 pts. 9,498

Comments