Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890
  1. Avatar for uihcv 71. uihcv Lv 1 5 pts. 9,611
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 4 pts. 9,611
  3. Avatar for phi16 73. phi16 Lv 1 4 pts. 9,608
  4. Avatar for carsonfb 74. carsonfb Lv 1 4 pts. 9,558
  5. Avatar for Glen B 75. Glen B Lv 1 4 pts. 9,539
  6. Avatar for Mike Lewis 76. Mike Lewis Lv 1 4 pts. 9,539
  7. Avatar for ViJay7019 77. ViJay7019 Lv 1 3 pts. 9,536
  8. Avatar for aendgraend 78. aendgraend Lv 1 3 pts. 9,535
  9. Avatar for Aikuiba 79. Aikuiba Lv 1 3 pts. 9,523
  10. Avatar for DScott 80. DScott Lv 1 3 pts. 9,498

Comments