Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,708
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,535
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,349
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,105
  1. Avatar for jebbiek 81. jebbiek Lv 1 3 pts. 9,483
  2. Avatar for weitzen 82. weitzen Lv 1 2 pts. 9,481
  3. Avatar for SKSbell 83. SKSbell Lv 1 2 pts. 9,476
  4. Avatar for JUMELLE54 84. JUMELLE54 Lv 1 2 pts. 9,474
  5. Avatar for smilingone 85. smilingone Lv 1 2 pts. 9,470
  6. Avatar for gdnskye 86. gdnskye Lv 1 2 pts. 9,464
  7. Avatar for JackONeill12 87. JackONeill12 Lv 1 2 pts. 9,461
  8. Avatar for hansvandenhof 88. hansvandenhof Lv 1 2 pts. 9,449
  9. Avatar for dssb 89. dssb Lv 1 2 pts. 9,448
  10. Avatar for Deleted player 90. Deleted player pts. 9,428

Comments