Placeholder image of a protein
Icon representing a puzzle

1259: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,067
  2. Avatar for Beta Folders 2. Beta Folders 68 pts. 10,065
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,041
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,039
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 10,030
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,989
  7. Avatar for Go Science 7. Go Science 5 pts. 9,987
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 9,957
  9. Avatar for Deleted group 9. Deleted group pts. 9,913
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,890
  1. Avatar for jebbiek 81. jebbiek Lv 1 3 pts. 9,483
  2. Avatar for weitzen 82. weitzen Lv 1 2 pts. 9,481
  3. Avatar for SKSbell 83. SKSbell Lv 1 2 pts. 9,476
  4. Avatar for JUMELLE54 84. JUMELLE54 Lv 1 2 pts. 9,474
  5. Avatar for smilingone 85. smilingone Lv 1 2 pts. 9,470
  6. Avatar for gdnskye 86. gdnskye Lv 1 2 pts. 9,464
  7. Avatar for JackONeill12 87. JackONeill12 Lv 1 2 pts. 9,461
  8. Avatar for hansvandenhof 88. hansvandenhof Lv 1 2 pts. 9,449
  9. Avatar for dssb 89. dssb Lv 1 2 pts. 9,448
  10. Avatar for Deleted player 90. Deleted player pts. 9,428

Comments