Placeholder image of a protein
Icon representing a puzzle

1270: Revisiting Puzzle 66: Cytochrome

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
August 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,909
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,631
  4. Avatar for Cannabis Crew 14. Cannabis Crew 1 pt. 8,469
  1. Avatar for tallguy-13088 31. tallguy-13088 Lv 1 40 pts. 9,144
  2. Avatar for Museka 32. Museka Lv 1 38 pts. 9,143
  3. Avatar for Norrjane 33. Norrjane Lv 1 37 pts. 9,141
  4. Avatar for Marvelz 34. Marvelz Lv 1 36 pts. 9,137
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 35 pts. 9,133
  6. Avatar for Satina 36. Satina Lv 1 34 pts. 9,131
  7. Avatar for kabubi 37. kabubi Lv 1 32 pts. 9,128
  8. Avatar for Vredeman 38. Vredeman Lv 1 31 pts. 9,127
  9. Avatar for aznarog 39. aznarog Lv 1 30 pts. 9,127
  10. Avatar for pmdpmd 40. pmdpmd Lv 1 29 pts. 9,127

Comments