Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245
  1. Avatar for cnhrcolemam 151. cnhrcolemam Lv 1 1 pt. 8,760
  2. Avatar for architekt1024 152. architekt1024 Lv 1 1 pt. 8,754
  3. Avatar for Datstandin 153. Datstandin Lv 1 1 pt. 8,752
  4. Avatar for jdguill43 154. jdguill43 Lv 1 1 pt. 8,752
  5. Avatar for pizpot 155. pizpot Lv 1 1 pt. 8,747
  6. Avatar for heyubob 156. heyubob Lv 1 1 pt. 8,740
  7. Avatar for euka 157. euka Lv 1 1 pt. 8,711
  8. Avatar for donckypoop 158. donckypoop Lv 1 1 pt. 8,710
  9. Avatar for gslee3134 159. gslee3134 Lv 1 1 pt. 8,674
  10. Avatar for Cerzax 160. Cerzax Lv 1 1 pt. 8,669

Comments