Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for rinze 131. rinze Lv 1 1 pt. 7,563
  2. Avatar for cherry39 132. cherry39 Lv 1 1 pt. 7,455
  3. Avatar for angelsinad 133. angelsinad Lv 1 1 pt. 7,413
  4. Avatar for alouiselivin 134. alouiselivin Lv 1 1 pt. 7,353
  5. Avatar for @lison 135. @lison Lv 1 1 pt. 7,348
  6. Avatar for johngran 136. johngran Lv 1 1 pt. 7,331
  7. Avatar for Robo909 137. Robo909 Lv 1 1 pt. 7,323
  8. Avatar for emdee314 138. emdee314 Lv 1 1 pt. 7,264
  9. Avatar for NickUnora19 139. NickUnora19 Lv 1 1 pt. 7,170
  10. Avatar for cating2011 140. cating2011 Lv 1 1 pt. 7,124

Comments