Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for bertro 11. bertro Lv 1 76 pts. 9,461
  2. Avatar for crpainter 12. crpainter Lv 1 74 pts. 9,458
  3. Avatar for mimi 13. mimi Lv 1 72 pts. 9,455
  4. Avatar for Madde 14. Madde Lv 1 70 pts. 9,453
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 68 pts. 9,448
  6. Avatar for Galaxie 16. Galaxie Lv 1 66 pts. 9,444
  7. Avatar for markm457 17. markm457 Lv 1 64 pts. 9,399
  8. Avatar for Museka 18. Museka Lv 1 62 pts. 9,396
  9. Avatar for MurloW 19. MurloW Lv 1 60 pts. 9,383
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 58 pts. 9,379

Comments