Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for Crossed Sticks 51. Crossed Sticks Lv 1 21 pts. 9,209
  2. Avatar for Aubade01 52. Aubade01 Lv 1 20 pts. 9,203
  3. Avatar for Mike Cassidy 53. Mike Cassidy Lv 1 20 pts. 9,192
  4. Avatar for traal 54. traal Lv 1 19 pts. 9,190
  5. Avatar for Glen B 55. Glen B Lv 1 18 pts. 9,189
  6. Avatar for Vinara 56. Vinara Lv 1 17 pts. 9,189
  7. Avatar for pvc78 57. pvc78 Lv 1 17 pts. 9,170
  8. Avatar for randomlil 58. randomlil Lv 1 16 pts. 9,147
  9. Avatar for tarimo 59. tarimo Lv 1 16 pts. 9,133
  10. Avatar for Keresto 60. Keresto Lv 1 15 pts. 9,129

Comments