Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for Hollinas 101. Hollinas Lv 1 4 pts. 9,029
  2. Avatar for Imeturoran 102. Imeturoran Lv 1 4 pts. 9,028
  3. Avatar for pizpot 103. pizpot Lv 1 4 pts. 9,028
  4. Avatar for Reldas 104. Reldas Lv 1 4 pts. 9,024
  5. Avatar for ViJay7019 105. ViJay7019 Lv 1 4 pts. 9,023
  6. Avatar for demeter900 106. demeter900 Lv 1 4 pts. 9,023
  7. Avatar for harvardman 107. harvardman Lv 1 3 pts. 9,020
  8. Avatar for Arne Heessels 108. Arne Heessels Lv 1 3 pts. 9,019
  9. Avatar for bendbob 109. bendbob Lv 1 3 pts. 9,018
  10. Avatar for poiuyqwert 110. poiuyqwert Lv 1 3 pts. 9,014

Comments