Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Contenders 100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772

  1. Avatar for ManVsYard 71. ManVsYard Lv 1 6 pts. 8,869
  2. Avatar for cbwest 72. cbwest Lv 1 6 pts. 8,863
  3. Avatar for tarimo 73. tarimo Lv 1 6 pts. 8,852
  4. Avatar for manu8170 74. manu8170 Lv 1 5 pts. 8,835
  5. Avatar for stomjoh 75. stomjoh Lv 1 5 pts. 8,831
  6. Avatar for pfirth 76. pfirth Lv 1 5 pts. 8,815
  7. Avatar for Marvelz 77. Marvelz Lv 1 4 pts. 8,802
  8. Avatar for Superphosphate 78. Superphosphate Lv 1 4 pts. 8,800
  9. Avatar for Deleted player 79. Deleted player pts. 8,794
  10. Avatar for JayD7217 80. JayD7217 Lv 1 4 pts. 8,791

Comments