Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,650
  2. Avatar for Go Science 2. Go Science 78 pts. 17,627
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 17,344
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 16,932
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 16,653
  6. Avatar for Deleted group 6. Deleted group pts. 16,499
  7. Avatar for Contenders 7. Contenders 17 pts. 16,180
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 15,894
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 15,447
  10. Avatar for xkcd 10. xkcd 6 pts. 14,977
  1. Avatar for JUMELLE54 101. JUMELLE54 Lv 1 2 pts. 14,610
  2. Avatar for Iron pet 102. Iron pet Lv 1 2 pts. 14,562
  3. Avatar for versat82 103. versat82 Lv 1 2 pts. 14,561
  4. Avatar for philcalhoun 104. philcalhoun Lv 1 2 pts. 14,553
  5. Avatar for joaniegirl 105. joaniegirl Lv 1 2 pts. 14,506
  6. Avatar for Mr_Jolty 106. Mr_Jolty Lv 1 2 pts. 14,501
  7. Avatar for parsnip 107. parsnip Lv 1 1 pt. 14,470
  8. Avatar for Marvelz 108. Marvelz Lv 1 1 pt. 14,458
  9. Avatar for rabamino12358 109. rabamino12358 Lv 1 1 pt. 14,435
  10. Avatar for leannerikicheever 110. leannerikicheever Lv 1 1 pt. 14,435

Comments