Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,518
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,511
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,496
  4. Avatar for Go Science 4. Go Science 33 pts. 9,485
  5. Avatar for Contenders 5. Contenders 22 pts. 9,330
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,190
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,157
  9. Avatar for freefolder 9. freefolder 3 pts. 9,151
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,986
  1. Avatar for frood66 21. frood66 Lv 1 50 pts. 9,397
  2. Avatar for actiasluna 22. actiasluna Lv 1 48 pts. 9,395
  3. Avatar for smilingone 23. smilingone Lv 1 46 pts. 9,394
  4. Avatar for phi16 24. phi16 Lv 1 45 pts. 9,373
  5. Avatar for reefyrob 25. reefyrob Lv 1 43 pts. 9,372
  6. Avatar for gitwut 26. gitwut Lv 1 41 pts. 9,330
  7. Avatar for Vinara 27. Vinara Lv 1 40 pts. 9,302
  8. Avatar for pauldunn 28. pauldunn Lv 1 38 pts. 9,302
  9. Avatar for katling 29. katling Lv 1 37 pts. 9,299
  10. Avatar for randomlil 30. randomlil Lv 1 35 pts. 9,261

Comments