Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,518
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,511
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,496
  4. Avatar for Go Science 4. Go Science 33 pts. 9,485
  5. Avatar for Contenders 5. Contenders 22 pts. 9,330
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,190
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,157
  9. Avatar for freefolder 9. freefolder 3 pts. 9,151
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,986
  1. Avatar for guineapig 51. guineapig Lv 1 14 pts. 9,093
  2. Avatar for crpainter 52. crpainter Lv 1 13 pts. 9,077
  3. Avatar for mimi 53. mimi Lv 1 13 pts. 9,068
  4. Avatar for jobo0502 54. jobo0502 Lv 1 12 pts. 9,067
  5. Avatar for Mike Cassidy 55. Mike Cassidy Lv 1 12 pts. 9,053
  6. Avatar for Museka 56. Museka Lv 1 11 pts. 9,038
  7. Avatar for dizzywings 57. dizzywings Lv 1 11 pts. 9,017
  8. Avatar for heather-1 58. heather-1 Lv 1 10 pts. 9,016
  9. Avatar for spvincent 59. spvincent Lv 1 10 pts. 9,014
  10. Avatar for SaraL 60. SaraL Lv 1 9 pts. 9,010

Comments